PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g004300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 287aa    MW: 31886.3 Da    PI: 10.2869
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g004300.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind361.41.8e-11012861301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd......maflqrdkalaernkalverdnkllal 84 
                     mdddg+  rn+gyyepa a++k nlglqlms+i +r++k+    re+nl ++++++++++r+      +++    +++++      ++dnk++++
  Csa04g004300.1   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRESNL-MIGSNGSYHPREheasmpINY----SWINQ------PKDNKFFNM 81 
                     99**99..9*******999**************.9**************.***********9886655555....9****......********* PP

       GAGA_bind  85 llvenslasalpvgvqvlsgtksidslqqlse.....pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkkseks 174
                     l++++      p++++v+s+t+  +s+q++++     +++e+++++        + ++++ +++ k++k++ + ++++ pk+kk +k+k++s   
  Csa04g004300.1  82 LPIST------PNYSNVMSETSGSNSMQMMHQsvvttSRFEENPIP-----PPREDETVQ-QPSGKKRKMRGSIATPTAPKAKKPRKPKEES--- 161
                     **766......8999**************99844444455555554.....333333333.4567778888888889999999999888844... PP

       GAGA_bind 175 kkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklL 269
                        v+++ +++r+k +kks+d+v+ngvs+D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRi+grKmSqgafkk+L
  Csa04g004300.1 162 --GVTNNVQQQRVKPPKKSVDVVINGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVL 254
                     ..34444445789********************************************************************************** PP

       GAGA_bind 270 ekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     ekLa+eGy+++n++DLk+hWA+HGtnkfvtir
  Csa04g004300.1 255 EKLATEGYSFGNAIDLKSHWARHGTNKFVTIR 286
                     *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.3E-1031286IPR010409GAGA-binding transcriptional activator
SMARTSM012266.1E-1711286IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMST IDRNTKPFLP GRESNLMIGS NGSYHPREHE  60
ASMPINYSWI NQPKDNKFFN MLPISTPNYS NVMSETSGSN SMQMMHQSVV TTSRFEENPI  120
PPPREDETVQ QPSGKKRKMR GSIATPTAPK AKKPRKPKEE SGVTNNVQQQ RVKPPKKSVD  180
VVINGVSMDI SGLPVPVCTC TGTPQQCYRW GCGGWQSACC TTNISMYPLP MSTKRRGARI  240
SGRKMSQGAF KKVLEKLATE GYSFGNAIDL KSHWARHGTN KFVTIR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545890.0AC254589.1 Capsella rubella clone CAP16-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010502189.10.0PREDICTED: protein BASIC PENTACYSTEINE1
SwissprotQ9SKD00.0BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLR0HH840.0R0HH84_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__107__AT2G01930.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.21e-172basic pentacysteine1